Web Analysis for Trickphotographyspecialeffects - trickphotographyspecialeffects.org
trick photography techniques how to shoot trick photos
1.67
Rating by CuteStat
trickphotographyspecialeffects.org is 1 decade 2 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, trickphotographyspecialeffects.org is SAFE to browse.
PageSpeed Score
76
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | 2 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 3 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.185.108.139)
Trick Photography Ideas
- trickphotographyideas.net
how to do trick photography and special effects review
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectsreview.net
how to do trick photography and special effects
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectspdf.net
how to do trick photography and special effects
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.4.5
Date: Tue, 04 Mar 2014 05:42:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://www.trickphotographyspecialeffects.org/xmlrpc.php
Link: <http://www.trickphotographyspecialeffects.org/?p=2>; rel=shortlink
Content-Encoding: gzip
Server: nginx/1.4.5
Date: Tue, 04 Mar 2014 05:42:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://www.trickphotographyspecialeffects.org/xmlrpc.php
Link: <http://www.trickphotographyspecialeffects.org/?p=2>; rel=shortlink
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1509.websitewelcome.com | 192.185.108.133 | United States of America | |
ns1510.websitewelcome.com | 192.185.108.134 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
trickphotographyspecialeffects.org | A | 14393 |
IP: 192.185.108.139 |
trickphotographyspecialeffects.org | NS | 21599 |
Target: ns1510.websitewelcome.com |
trickphotographyspecialeffects.org | NS | 21599 |
Target: ns1509.websitewelcome.com |
trickphotographyspecialeffects.org | SOA | 21599 |
MNAME: ns1509.websitewelcome.com RNAME: root.packard.websitewelcome.com Serial: 2014022403 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
trickphotographyspecialeffects.org | MX | 14399 |
Target: trickphotographyspecialeffects.org |
trickphotographyspecialeffects.org | TXT | 14399 |
TXT: v=spf1 a mx include:websitewelcome.com ~all |
Full WHOIS Lookup
Domain Name:TRICKPHOTOGRAPHYSPECIALEFFECTS.ORG
Domain ID: D171215982-LROR
Creation Date: 2014-02-24T06:31:10Z
Updated Date: 2014-02-24T06:37:29Z
Registry Expiry Date: 2015-02-24T06:31:10Z
Sponsoring Registrar:GoDaddy.com, LLC (R91-LROR)
Sponsoring Registrar IANA ID: 146
WHOIS Server:
Referral URL:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverTransferProhibited
Registrant ID:CR161686701
Registrant Name:Lori H. Walker
Registrant Organization:
Registrant Street: 1261 Alexander Avenue
Registrant City:Concord
Registrant State/Province:California
Registrant Postal Code:94520
Registrant Country:US
Registrant Phone:+1.9256770317
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:admin@trickphotographyspecialeffects.org
Admin ID:CR161686703
Admin Name:Lori H. Walker
Admin Organization:
Admin Street: 1261 Alexander Avenue
Admin City:Concord
Admin State/Province:California
Admin Postal Code:94520
Admin Country:US
Admin Phone:+1.9256770317
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:admin@trickphotographyspecialeffects.org
Tech ID:CR161686702
Tech Name:Lori H. Walker
Tech Organization:
Tech Street: 1261 Alexander Avenue
Tech City:Concord
Tech State/Province:California
Tech Postal Code:94520
Tech Country:US
Tech Phone:+1.9256770317
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:admin@trickphotographyspecialeffects.org
Name Server:NS1510.WEBSITEWELCOME.COM
Name Server:NS1509.WEBSITEWELCOME.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to .ORG WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
Domain ID: D171215982-LROR
Creation Date: 2014-02-24T06:31:10Z
Updated Date: 2014-02-24T06:37:29Z
Registry Expiry Date: 2015-02-24T06:31:10Z
Sponsoring Registrar:GoDaddy.com, LLC (R91-LROR)
Sponsoring Registrar IANA ID: 146
WHOIS Server:
Referral URL:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverTransferProhibited
Registrant ID:CR161686701
Registrant Name:Lori H. Walker
Registrant Organization:
Registrant Street: 1261 Alexander Avenue
Registrant City:Concord
Registrant State/Province:California
Registrant Postal Code:94520
Registrant Country:US
Registrant Phone:+1.9256770317
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:admin@trickphotographyspecialeffects.org
Admin ID:CR161686703
Admin Name:Lori H. Walker
Admin Organization:
Admin Street: 1261 Alexander Avenue
Admin City:Concord
Admin State/Province:California
Admin Postal Code:94520
Admin Country:US
Admin Phone:+1.9256770317
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:admin@trickphotographyspecialeffects.org
Tech ID:CR161686702
Tech Name:Lori H. Walker
Tech Organization:
Tech Street: 1261 Alexander Avenue
Tech City:Concord
Tech State/Province:California
Tech Postal Code:94520
Tech Country:US
Tech Phone:+1.9256770317
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:admin@trickphotographyspecialeffects.org
Name Server:NS1510.WEBSITEWELCOME.COM
Name Server:NS1509.WEBSITEWELCOME.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Access to .ORG WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.